PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626405.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 286aa    MW: 32380.9 Da    PI: 5.2462
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626405.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013626405.1 14 RGPWTPEEDQILISFIHKHGHNNWRALPKQAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding50.84e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++ +++ lG++ W++Ia++++ gRt++++k+ w+++l
   XP_013626405.1  67 RGNFTKEEEDAIISLHQVLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.842961IPR017930Myb domain
SuperFamilySSF466895.75E-3111108IPR009057Homeodomain-like
SMARTSM007172.8E-151363IPR001005SANT/Myb domain
PfamPF002492.2E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-261568IPR009057Homeodomain-like
CDDcd001679.47E-131661No hitNo description
PROSITE profilePS5129424.94762116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001672.23E-1069112No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRAPCCEKM GLQRGPWTPE EDQILISFIH KHGHNNWRAL PKQAGLLRCG KSCRLRWMNY  60
LKPDIKRGNF TKEEEDAIIS LHQVLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLEDYQ  120
PAKPKSSNKK HGTKPKSQSV AAKLNSTRSE SELGNSSNPS FESLFSASPS TSDEVSSVTL  180
MSHEGHNNEA KMDNKLGDIS TADQDCFSFE NFGADIDESF WNEALYSQDE HNYASNLEVT  240
GFDDETQQEF QQLGSVENEM VFDSEMDFWY DVFVRTGGEQ ELLAGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121175109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894830.0AC189483.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB083F05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626405.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D3BCW80.0A0A0D3BCW8_BRAOL; Uncharacterized protein
STRINGBra001907.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.10.0myb domain protein 15